assl | A library to hide awful OpenSSL API in a sane interface | TLS library

by conformal C Version: Current License: No License

X-Ray Key Features Code Snippets Community Discussions(3)Vulnerabilities Install Support

kandi X-RAY | assl Summary

assl is a C library typically used in Security, TLS applications. assl has no bugs, it has no vulnerabilities and it has low support. You can download it from GitHub.

assl (Agglomerated SSL) was written in order to hide the awful OpenSSL API. It strives to reuse the OpenSSL APIs and provide a much simpler and sane interface for programmers that are interested in writing applications that require the SSL/TLS protocol for secure communications.

Support

Quality

Security

License

Reuse

Support

assl has a low active ecosystem.

It has 11 star(s) with 5 fork(s). There are 7 watchers for this library.

It had no major release in the last 6 months.

assl has no issues reported. There are 1 open pull requests and 0 closed requests.

It has a neutral sentiment in the developer community.

The latest version of assl is current.

Quality

assl has no bugs reported.

Security

assl has no vulnerabilities reported, and its dependent libraries have no vulnerabilities reported.

License

assl does not have a standard license declared.

Check the repository for any license declaration and review the terms closely.

Without a license, all rights are reserved, and you cannot use the library in your applications.

Reuse

assl releases are not available. You will need to build from source code and install.

Top functions reviewed by kandi - BETA

kandi's functional review helps you automatically verify the functionalities of the libraries and avoid rework.
Currently covering the most popular Java, JavaScript and Python libraries. See a Sample of assl

Get all kandi verified functions for this library.

assl Key Features

No Key Features are available at this moment for assl.

assl Examples and Code Snippets

No Code Snippets are available at this moment for assl.

Community Discussions

Trending Discussions on assl

Problems with getting the needed lines with regex

SSIS Task: Process SSAS Cube and Parametrize Connection Strings

Get nested dictionary

QUESTION

Problems with getting the needed lines with regex

Asked 2019-Oct-11 at 13:31

i am new in the regex expression function with python. I have a file where i need to filter the aminoacid-sequence. Here is a quick look into the file:

>nxp:NX_A0A0A6YYD4-1 \PName=T cell receptor beta variable 13 isoform Iso 1 \GName=TRBV13 \NcbiTaxId=9606 \TaxName=Homo Sapiens \Length=124 \SV=5 \EV=31 \PE=3 \ModResPsi=(52|MOD:00798|half cystine)(120|MOD:00798|half cystine) \ModRes=(106||N-linked (GlcNAc...) asparagine) \VariantSimple=(18|H)(27|V) \Processed=(1|31|PEFF:0001021|signal peptide)(32|124|PEFF:0001020|mature protein) MLSPDLPDSAWNTRLLCRVMLCLLGAGSVAAGVIQSPRHLIKEKRETATLKCYPIPRHDT VYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFC ASSL

>nxp:NX_A0A1B0GV90-1 \PName=Cortexin domain containing 2 isoform Iso 1 \GName=CTXND2 \NcbiTaxId=9606 \TaxName=Homo Sapiens \Length=55 \SV=1 \EV=11 \PE=3 \VariantSimple=(13|N)(22|F)(29|T)(34|Q)(45|T) \Processed=(1|55|PEFF:0001020|mature protein) MEDSSLSSGVDVDKGFAIAFVVLLFLFLIVMIFRCAKLVKNPYKASSTTTEPSLS

I could filter out the endpoint of the needed point and the starting point. As you can see in my code, the beginning ist after the coordinates after the \VarableSimple and the end should be the next ">" character. Now i cannot find the way to filter out the MLSPDLPD..... sequence. Could someone give me an idea?

...

ANSWER

Answered 2019-Oct-11 at 13:31

In general there are 3 ways to parse data like this:

Use str methods.
Use regex, e.g. with re.
Use a parser, e.g. parsimonious

Here's a really fantastic answer on SO about using regex and parsers.

They are all fiddly. But string methods are easy to debug, and regex and parsers... aren't. So my first move would be to try to unpack the data with string methods, maybe like this:

Source https://stackoverflow.com/questions/58341825

QUESTION

SSIS Task: Process SSAS Cube and Parametrize Connection Strings

Asked 2019-Apr-08 at 15:30

I want to process an SSAS Cube in SSIS. Is there a way to parametrize connection strings for Datamart SQL Server data source? I want to be able to set/configure SQL Server Connecting strings for our SSAS Dev, Test, and Production Environments in Devops.

Currently datamart cubes have connections hardcoded in SSAS, SSAS does not seem to have project connection strings like SSIS.

Update:

I heard something about in SSIS ---> Analysis Services Execute DDL Task --> running an XMLA script to change the database connection string. Not sure how to conduct this.

Can someone provide direction or trim down this XMLA script to only change connection string (Sql server and Database name)? Just want to only change what is necessary. I am using SSAS 2016 so might need to update the schema xmlns.

Also receiving this error: Have SQL Server 2016 and 2016 SSAS

Errors in the metadata manager. The object definition supplied for the ALTER statement is of a different type that the object reference to be altered.

How would I fix this?

...

ANSWER

Answered 2019-Apr-07 at 20:54

Go to SSMS ---> Analysis Services

Script Datasource --> Alter to ---> New Query Window

Can change data source here

Copy Alter Scripts command into variable in SSIS, and use 'Execute Analysis Services DDL Task'

Source https://stackoverflow.com/questions/55562662

QUESTION

Get nested dictionary

Asked 2018-Nov-09 at 17:32

I have a datarow in excel as

'Ars','Cr','Assl','Burg','Consp'

I want to convert it into nested dictionary like this

...

ANSWER

Answered 2018-Nov-09 at 17:14

l = ['Ars','Cr','Assl','Burg','Consp']

d_ = d = {}

for name, val in zip(l, l[1:]):
    d['name'] = val
    d['children'] = d = {}

d_

Source https://stackoverflow.com/questions/53230323

Community Discussions, Code Snippets contain sources that include Stack Exchange Network

Vulnerabilities

No vulnerabilities reported

Install assl

You can download it from GitHub.

Support

For any new features, suggestions and bugs create an issue on GitHub. If you have any questions check and ask questions on community page Stack Overflow .

Find more information at: