ASSL | Automatic SSL creation by AKB @ LET | TLS library

by Vittfarne PHP Version: Current License: No License

X-Ray Key Features Code Snippets Community Discussions(3)Vulnerabilities Install Support

kandi X-RAY | ASSL Summary

ASSL is a PHP library typically used in Security, TLS applications. ASSL has no bugs, it has no vulnerabilities and it has low support. You can download it from GitHub.

Check LET for info.

Support

Quality

Security

License

Reuse

Support

ASSL has a low active ecosystem.

It has 197 star(s) with 107 fork(s). There are 10 watchers for this library.

It had no major release in the last 6 months.

There are 1 open issues and 10 have been closed. On average issues are closed in 14 days. There are no pull requests.

It has a neutral sentiment in the developer community.

The latest version of ASSL is current.

Quality

ASSL has 0 bugs and 0 code smells.

Security

ASSL has no vulnerabilities reported, and its dependent libraries have no vulnerabilities reported.

ASSL code analysis shows 0 unresolved vulnerabilities.

There are 0 security hotspots that need review.

License

ASSL does not have a standard license declared.

Check the repository for any license declaration and review the terms closely.

Without a license, all rights are reserved, and you cannot use the library in your applications.

Reuse

ASSL releases are not available. You will need to build from source code and install.

ASSL saves you 650 person hours of effort in developing the same functionality from scratch.

It has 1509 lines of code, 6 functions and 7 files.

It has low code complexity. Code complexity directly impacts maintainability of the code.

Top functions reviewed by kandi - BETA

kandi's functional review helps you automatically verify the functionalities of the libraries and avoid rework.
Currently covering the most popular Java, JavaScript and Python libraries. See a Sample of ASSL

Get all kandi verified functions for this library.

ASSL Key Features

No Key Features are available at this moment for ASSL.

ASSL Examples and Code Snippets

No Code Snippets are available at this moment for ASSL.

Community Discussions

Trending Discussions on ASSL

Problems with getting the needed lines with regex

SSIS Task: Process SSAS Cube and Parametrize Connection Strings

Get nested dictionary

QUESTION

Problems with getting the needed lines with regex

Asked 2019-Oct-11 at 13:31

i am new in the regex expression function with python. I have a file where i need to filter the aminoacid-sequence. Here is a quick look into the file:

>nxp:NX_A0A0A6YYD4-1 \PName=T cell receptor beta variable 13 isoform Iso 1 \GName=TRBV13 \NcbiTaxId=9606 \TaxName=Homo Sapiens \Length=124 \SV=5 \EV=31 \PE=3 \ModResPsi=(52|MOD:00798|half cystine)(120|MOD:00798|half cystine) \ModRes=(106||N-linked (GlcNAc...) asparagine) \VariantSimple=(18|H)(27|V) \Processed=(1|31|PEFF:0001021|signal peptide)(32|124|PEFF:0001020|mature protein) MLSPDLPDSAWNTRLLCRVMLCLLGAGSVAAGVIQSPRHLIKEKRETATLKCYPIPRHDT VYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFC ASSL

>nxp:NX_A0A1B0GV90-1 \PName=Cortexin domain containing 2 isoform Iso 1 \GName=CTXND2 \NcbiTaxId=9606 \TaxName=Homo Sapiens \Length=55 \SV=1 \EV=11 \PE=3 \VariantSimple=(13|N)(22|F)(29|T)(34|Q)(45|T) \Processed=(1|55|PEFF:0001020|mature protein) MEDSSLSSGVDVDKGFAIAFVVLLFLFLIVMIFRCAKLVKNPYKASSTTTEPSLS

I could filter out the endpoint of the needed point and the starting point. As you can see in my code, the beginning ist after the coordinates after the \VarableSimple and the end should be the next ">" character. Now i cannot find the way to filter out the MLSPDLPD..... sequence. Could someone give me an idea?

...

ANSWER

Answered 2019-Oct-11 at 13:31

In general there are 3 ways to parse data like this:

Use str methods.
Use regex, e.g. with re.
Use a parser, e.g. parsimonious

Here's a really fantastic answer on SO about using regex and parsers.

They are all fiddly. But string methods are easy to debug, and regex and parsers... aren't. So my first move would be to try to unpack the data with string methods, maybe like this:

Source https://stackoverflow.com/questions/58341825

QUESTION

SSIS Task: Process SSAS Cube and Parametrize Connection Strings

Asked 2019-Apr-08 at 15:30

I want to process an SSAS Cube in SSIS. Is there a way to parametrize connection strings for Datamart SQL Server data source? I want to be able to set/configure SQL Server Connecting strings for our SSAS Dev, Test, and Production Environments in Devops.

Currently datamart cubes have connections hardcoded in SSAS, SSAS does not seem to have project connection strings like SSIS.

Update:

I heard something about in SSIS ---> Analysis Services Execute DDL Task --> running an XMLA script to change the database connection string. Not sure how to conduct this.

Can someone provide direction or trim down this XMLA script to only change connection string (Sql server and Database name)? Just want to only change what is necessary. I am using SSAS 2016 so might need to update the schema xmlns.

Also receiving this error: Have SQL Server 2016 and 2016 SSAS

Errors in the metadata manager. The object definition supplied for the ALTER statement is of a different type that the object reference to be altered.

How would I fix this?

...

ANSWER

Answered 2019-Apr-07 at 20:54

Go to SSMS ---> Analysis Services

Script Datasource --> Alter to ---> New Query Window

Can change data source here

Copy Alter Scripts command into variable in SSIS, and use 'Execute Analysis Services DDL Task'

Source https://stackoverflow.com/questions/55562662

QUESTION

Get nested dictionary

Asked 2018-Nov-09 at 17:32

I have a datarow in excel as

'Ars','Cr','Assl','Burg','Consp'

I want to convert it into nested dictionary like this

...

ANSWER

Answered 2018-Nov-09 at 17:14

l = ['Ars','Cr','Assl','Burg','Consp']

d_ = d = {}

for name, val in zip(l, l[1:]):
    d['name'] = val
    d['children'] = d = {}

d_

Source https://stackoverflow.com/questions/53230323

Community Discussions, Code Snippets contain sources that include Stack Exchange Network

Vulnerabilities

No vulnerabilities reported

Install ASSL

You can download it from GitHub.
PHP requires the Visual C runtime (CRT). The Microsoft Visual C++ Redistributable for Visual Studio 2019 is suitable for all these PHP versions, see visualstudio.microsoft.com. You MUST download the x86 CRT for PHP x86 builds and the x64 CRT for PHP x64 builds. The CRT installer supports the /quiet and /norestart command-line switches, so you can also script it.

Support

For any new features, suggestions and bugs create an issue on GitHub. If you have any questions check and ask questions on community page Stack Overflow .

Find more information at: